PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK25206.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 287aa    MW: 32827.1 Da    PI: 6.784
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK25206.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.55.1e-5371311128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeelv++yL++k++++++++  +i+e+d+yk++PwdLp  ++ +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   + v
  PK25206.1   7 LPPGFRFHPTDEELVMHYLCRKCASQPISV-PIIAEIDLYKYDPWDLPGLATYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGN--PKPV 103
                79****************************.88***************7667789*************************************98..789* PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+apkgekt+W+mheyrl
  PK25206.1 104 GIKKALVFYAGKAPKGEKTNWIMHEYRL 131
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-633157IPR003441NAC domain
PROSITE profilePS5100561.1517157IPR003441NAC domain
PfamPF023651.2E-278131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MTGELELPPG FRFHPTDEEL VMHYLCRKCA SQPISVPIIA EIDLYKYDPW DLPGLATYGE  60
KEWYFFSPRD RKYPNGSRPN RAAGTGYWKA TGADKPIGNP KPVGIKKALV FYAGKAPKGE  120
KTNWIMHEYR LADVDRSARK KNSLRLDDWV LCRIYNKKGS IEKKHQFNSN RNLSFPEIEE  180
KKPEILNTLP PPPQPAATTT TGGNDFVYFD TSESVPRLHT DSSCSEHVVS PEFTCEVQSE  240
PKWKDDWDKA LDFPYNYMDA TVDNSFGPAG NQMSPLQDIF MYLQKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-80316311174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095416.11e-178NAC domain-containing protein 2
SwissprotQ390131e-154NAC2_ARATH; NAC domain-containing protein 2
TrEMBLW9R9L01e-178W9R9L0_9R
STRINGPOPTR_0002s08150.11e-163(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-150NAC family protein